PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI07G18060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YB
Protein Properties Length: 223aa    MW: 23256.7 Da    PI: 7.0774
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI07G18060.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB184.58.4e-5821116297
            NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                      reqdrflPianvsrimk++lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfedy++plk+yl+k+releg
  OMERI07G18060.1  21 REQDRFLPIANVSRIMKRALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYIDPLKLYLHKFRELEG 114
                      89******************************************************************************************** PP

            NF-YB  96 ek 97 
                      ek
  OMERI07G18060.1 115 EK 116
                      97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.7E-5318127IPR009072Histone-fold
SuperFamilySSF471137.3E-4023120IPR009072Histone-fold
PfamPF008081.6E-272690IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006156.8E-205472No hitNo description
PROSITE patternPS0068505773IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006156.8E-207391No hitNo description
PRINTSPR006156.8E-2092110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MPDSDNESGG PSNAGEYASA REQDRFLPIA NVSRIMKRAL PANAKISKDA KETVQECVSE  60
FISFITGEAS DKCQREKRKT INGDDLLWAM TTLGFEDYID PLKLYLHKFR ELEGEKAIGA  120
AGSGGGSAGA ASSGGSGSQH HQDASRNNGG YGMYGGGGGG MIMMMGQPMY GSPPASAGYA  180
QPPPPHHHHH HQMVMGGKSG YGHGGGGGGG PSPSSGYGRQ DRL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B5e-4821111292Transcription factor HapC (Eurofung)
4g92_B5e-4821111292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2880370.0AB288037.1 Oryza sativa Japonica Group OsHAP3F gene for HAP3 subunit of HAP complex, complete cds.
GenBankAK1116210.0AK111621.1 Oryza sativa Japonica Group cDNA clone:J013109P12, full insert sequence.
GenBankAK1121180.0AK112118.1 Oryza sativa Japonica Group cDNA clone:002-139-C11, full insert sequence.
GenBankAP0051930.0AP005193.3 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0493C06.
GenBankAP0064580.0AP006458.4 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OSJNBa0072I06.
GenBankAP0149630.0AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645521.11e-94PREDICTED: nuclear transcription factor Y subunit B-3
SwissprotO233102e-71NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLA0A0E0EE521e-162A0A0E0EE52_9ORYZ; Uncharacterized protein
STRINGORGLA07G0165600.15e-95(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.12e-71nuclear factor Y, subunit B3